.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ueb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of elongation factor P from Thermus thermophilus HB8. Proc.Natl.Acad.Sci.USA 101 9595-9600 2004
    Site RSGI
    PDB Id 1ueb Target Id ttk003000860.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14458, Molecular Weight 20224.10 Da.
    Residues 184 Isoelectric Point 4.85
    Sequence misvtdlrpgtkvkmdgglwecveyqhqklgrggakvvakfknletgatvertfnsgeklediyvetre lqylypegeemvfmdletyeqfavprsrvvgaeffkegmtalgdmyegqpikvtpptvvelkvvdtppg vrgdtvsggskpatletgavvqvplfvepgevikvdtrtgeyvgra
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.65 Rfree 0.241
    Matthews' coefficent 2.80 Rfactor 0.213
    Waters 407 Solvent Content 55.72

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch