.
The Open Protein Structure Annotation Network
PDB Keyword
.

1uek

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of 4-(Cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase, an Enzyme in the Non-mevalonate Pathway of Isoprenoid Synthesis. J.Biol.Chem. 278 30022-30027 2003
    Site RSGI
    PDB Id 1uek Target Id ttk003000241.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14303, Molecular Weight 29250.89 Da.
    Residues 275 Isoelectric Point 6.94
    Sequence merlapakvnlglsvrfrredgyhelhtlfapfsladrlvvepvssglhfqgpygrenlayraaslyle aagqpggvrillekripegaglgggssdaaqvllalqalypaevdlfalartlgadvpffllgrgaear gvgerlkplalppvpavvffpglrvptplvyravrpedfgpdlpveailealargeeppywnslegpaf rlfpelkevrgrmralglrgvlmsgsgsaffglaegpdharraaealrawgrawagtlgggdagsgpa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.21796
    Matthews' coefficent 1.97 Rfactor 0.18248
    Waters 198 Solvent Content 37.03

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch