The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Divergent evolutions of trinucleotide polymerization revealed by an archaeal CCA-adding enzyme structure. Embo J. 22 5918-5927 2003
    Site RSGI
    PDB Id 1uet Target Id my_001000010.1
    Molecular Characteristics
    Source Archaeoglobus fulgidus
    Alias Ids TPS13670, Molecular Weight 51382.55 Da.
    Residues 437 Isoelectric Point 6.77
    Sequence mkveeilekalelvipdeeevrkgreaeeelrrrldelgveyvfvgsyarntwlkgsleidvfllfpee fskeelrergleigkavldsyeiryaehpyvhgvvkgvevdvvpcyklkepkniksavdrtpfhhkwle grikgkenevrllkgflkangiygaeykvrgfsgylcellivfygsfletvknarrwtrrtvidvakge vrkgeeffvvdpvdekrnvaanlsldnlarfvhlcrefmeapslgffkpkhpleieperlrkiveergt avfavkfrkpdivddnlypqlerasrkifeflerenfmplrsafkaseefcyllfecqikeisrvfrrm gpqfedernvkkflsrnrafrpfiengrwwafemrkfttpeegvrsyasthwhtlgknvgesireyfei isgeklfkepvtaelcemmgvkd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.242
    Matthews' coefficent 2.47 Rfactor 0.198
    Waters 304 Solvent Content 50.13

    Ligand Information
    Ligands ACT (ACETATE) x 1
    Metals CA (CALCIUM) x 3;MG (MAGNESIUM) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch