The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the first PDZ domain of human KIAA1526 protein. To be Published
    Site RSGI
    PDB Id 1uez Target Id hsk002001498.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12656, Molecular Weight 9391.37 Da.
    Residues 88 Isoelectric Point 10.08
    Sequence evrlvslrrakaheglgfsirggsehgvgiyvslvepgslaekeglrvgdqilrvndkslarvthaeav kalkgskklvlsvysagri
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch