.
The Open Protein Structure Annotation Network
PDB Keyword
.

1uf3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of TT1561 of thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 1uf3 Target Id ttk003001561.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14740, Molecular Weight 25666.08 Da.
    Residues 228 Isoelectric Point 5.93
    Sequence mrrtvryilatsnpmgdlealekfvklapdtgadaialignlmpkaaksrdyaaffrilseahlptayv pgpqdapiweylreaanvelvhpemrnvhetftfwrgpylvagvggeiadegepeehealrypawvaey rlkalwelkdypkiflfhtmpyhkglneqgshevahlikthnpllvlvagkgqkhemlgaswvvvpgdl segeyslldlrarkletgnvr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.10 Rfree 0.245
    Matthews' coefficent 2.26 Rfactor 0.195
    Waters 802 Solvent Content 45.12

    Ligand Information
    Ligands
    Metals CA (CALCIUM) x 14

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch