.
The Open Protein Structure Annotation Network
PDB Keyword
.

1uf9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title ATP-induced structural change of dephosphocoenzyme A kinase from Thermus thermophilus HB8. PROTEINS 58 235-242 2005
    Site RSGI
    PDB Id 1uf9 Target Id ttk003001252.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14666, Molecular Weight 22661.01 Da.
    Residues 203 Isoelectric Point 8.05
    Sequence mgheakhpiiigitgnigsgkstvaallrswgypvldldalaararenkeeelkrlfpeavvggrldrr alarlvfsdperlkaleavvhpevrrllmeelsrleaplvfleipllfekgwegrlhgtllvaapleer vrrvmarsglsreevlareraqmpeeekrkratwvlentgsledleralkavlaeltggakegrg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.80 Rfree 0.3
    Matthews' coefficent 2.88 Rfactor 0.222
    Waters 35 Solvent Content 57.31

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1;ATP (ADENOSINE-5'-TRIPHOSPHATE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch