.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ufa

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of TT1467 from Thermus thermophilus HB8. To be published
    Site RSGI
    PDB Id 1ufa Target Id ttk003001467.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14729, Molecular Weight 59165.83 Da.
    Residues 520 Isoelectric Point 5.82
    Sequence marfalvlhahlpyvrahgmwpfgeetlyeamaetylplirvlerlraegveapftlgitpilaeqlad arikegfwayakdrleraqgdyqryrgtaleasarhqvafweltldhfqrlsgdlvaafrkaeeggqve litsnathgyspllgydealwaqiktgvstyrrhfakdptgfwlpemayrpkgpwkppvegppegvrpg vdellmragirytfvdahlvqggeplspygeaalgpvesqeatyhvhelesglrvlarnpettlqvwsa dygypgeglyrefhrkdplsglhhwrvthrkadlaekapydpeaafakteeharhfvgllerlagrhpe gvilspydaelfghwwyegvawleavlrllaqnpkvrpvtareavqgpavrtalpegswgrggdhrvwl nektldywekvyraegamreaarrgvlpegvlrqamrelllleasdwpflmetgqaeayareryeehar affhllkgaspeelraleerdnpfpeadprlylfrea
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.238
    Matthews' coefficent 2.21 Rfactor 0.187
    Waters 296 Solvent Content 44.25

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch