The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of immunoglobulin like domain of mouse nuclear lamin. To be Published
    Site RSGI
    PDB Id 1ufg Target Id mmk001003188.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13436, Molecular Weight 15267.31 Da.
    Residues 138 Isoelectric Point 10.00
    Sequence qsqgggsvtkkrklessesrssfsqhartsgrvaveevdeegkfvrlrnksnedqsmgnwqirrqngdd plmtyrfppkftlkagqvvtiwasgagathspptdlvwkaqntwgcgsslrtalinstgeevamrklvr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch