.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ufl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structures of the signal transducing protein GlnK from Thermus thermophilus HB8. J.Struct.Biol. 149 99-110 2005
    Site RSGI
    PDB Id 1ufl Target Id ttk003001020.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14509, Molecular Weight 12881.29 Da.
    Residues 116 Isoelectric Point 5.77
    Sequence mklivaivrpeklnevlealfqaevrgltlsrvqghggetervetyrgttvkmelhekvrleigvsepf vkptveailkaartgevgdgkifvlpvekvyrirtgeedeaavtpvq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.70 Rfree 0.307
    Matthews' coefficent 1.99 Rfactor 0.23
    Waters 35 Solvent Content 38.09

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch