.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ufr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of TT1027 from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 1ufr Target Id ttk003001027.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14514, Molecular Weight 20465.51 Da.
    Residues 181 Isoelectric Point 6.46
    Sequence mrfkaelmnapemrralyriaheiveankgteglalvgihtrgiplahriarfiaefegkevpvgvldi tlyrddlteigyrpqvretripfdltgkaivlvddvlytgrtaraaldalidlgrprriylavlvdrgh relpiradfvgknvptsrsevvkvkveevdgedrvelwerega
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.60 Rfree 0.287
    Matthews' coefficent 2.94 Rfactor 0.264
    Waters 83 Solvent Content 58.23

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch