.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ufy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of Chorismate Mutase from Thermus Thermophilus. To be Published
    Site RSGI
    PDB Id 1ufy Target Id ttk003000008.3
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14155, Molecular Weight 13709.05 Da.
    Residues 122 Isoelectric Point 5.60
    Sequence mvrgirgaitveedtpeaihqatrelllkmleangiqsyeelaaviftvtedltfafpaeaarqigmhr vpllsarevpvpgslprvirvlalwntdtpqdrvrhvylreavrlrpdlesaq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 0.96 Rfree 0.1274
    Matthews' coefficent 2.71 Rfactor 0.1099
    Waters 132 Solvent Content 54.70

    Ligand Information
    Ligands MLI (MALONATE) x 1;MES (2-(N-MORPHOLINO)-ETHANESULFONIC) x 4
    Metals CL (CHLORIDE) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch