The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of HBS1-like domain in hypothetical protein BAB28515. To be Published
    Site RSGI
    PDB Id 1ufz Target Id mmk001004240.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13448, Molecular Weight 7974.43 Da.
    Residues 70 Isoelectric Point 4.43
    Sequence eygyedlressnsllnhqlseidqarlyscldhmrevlgdavpddilteailkhkfdvqkalsvvleqdg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch