The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of SURP domain in BAB30904. To be Published
    Site RSGI
    PDB Id 1ug0 Target Id mmk001002415.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13432, Molecular Weight 8962.65 Da.
    Residues 75 Isoelectric Point 5.22
    Sequence eedyeqwleikvsppegaetrrvieklarfvaeggpelekvamedykdnpaftflhdknsreflyyrrk vaeirk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch