The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR structure of the R3H domain from Poly(A)-specific Ribonuclease. To be Published
    Site RSGI
    PDB Id 1ug8 Target Id mmk001005079.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13454, Molecular Weight 8935.72 Da.
    Residues 74 Isoelectric Point 5.39
    Sequence dqkkfidqviekiedflqseekrsleldpctgfqrkliyqtlswkypkgihvetletdkkerhiviskv deeer
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch