.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ugj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of a murine hypothetical protein from RIKEN cDNA 2310057J16. To be Published
    Site RSGI
    PDB Id 1ugj Target Id mmk001001534.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13429, Molecular Weight 14638.08 Da.
    Residues 128 Isoelectric Point 9.58
    Sequence prlykepsaksnkfiihnalshcclagkvnepqknrileeiekskanhflilfrdsscqfralytlsge teelsrlagygprtvtpamvegiykynsdrkrftqipaktmsmsvdaftiqghlwqskk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch