The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The linker histone homolog Hho1p from Saccharomyces cerevisiae represents a winged helix-turn-helix fold as determined by NMR spectroscopy. Nucleic Acids Res. 31 7199-7207 2003
    Site RSGI
    PDB Id 1uhm Target Id trt001000359.1
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS14138, Molecular Weight 8501.30 Da.
    Residues 78 Isoelectric Point 9.70
    Sequence eassksyreliiegltalkerkgssrpalkkfikenypivgsasnfdlyfnnaikkgveagdfeqpkgp agavklakk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch