.
The Open Protein Structure Annotation Network
PDB Keyword
.

1uhr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the SWIB domain of mouse BRG1-associated factor 60a. To be Published
    Site RSGI
    PDB Id 1uhr Target Id mmt007019221.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13573, Molecular Weight 9626.84 Da.
    Residues 80 Isoelectric Point 9.36
    Sequence qppqfkldprlarllgihtqtrpviiqalwqyikthklqdpherefvlcdkylqqifesqrmkfseipq rlhallmppep
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch