.
The Open Protein Structure Annotation Network
PDB Keyword
.

1uhu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the retroviral Gag MA-like domain of RIKEN cDNA 3110009E22. To be Published
    Site RSGI
    PDB Id 1uhu Target Id mmk001004487.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13451, Molecular Weight 10573.41 Da.
    Residues 92 Isoelectric Point 5.12
    Sequence tplsltldhwseirsrahnlsveikkgpwrtfcasewptfdvgwppegtfdltvifevkaivfqdgpgs hpdqqpyitvwqdlvqnsppwik
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch