The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a Family 4 Uracil-DNA Glycosylase from Thermus thermophilus HB8. J.Mol.Biol. 333 515-526 2003
    Site RSGI
    PDB Id 1ui1 Target Id ttk003000721.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14416, Molecular Weight 22964.66 Da.
    Residues 205 Isoelectric Point 9.06
    Sequence mtlellqaqaqnctacrlmegrtrvvfgegnpdaklmivgegpgeeedktgrpfvgkagqllnrileaa gipreevyitnivkcrppqnraplpdeakictdkwllkqieliapqiivplgavaaefflgekvsitkv rgkwyewhgikvfpmfhpayllrnpsrapgspkhltwldiqevkraldalppkerrpvkavsqeplf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.80 Rfree 0.276
    Matthews' coefficent 2.63 Rfactor 0.214
    Waters Solvent Content 52.89

    Ligand Information
    Ligands SF4 (IRON/SULFUR) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch