.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ui9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of chorismate mutase from thermus thermophilus. To be Published
    Site RSGI
    PDB Id 1ui9 Target Id ttk003000008.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14154, Molecular Weight 13709.05 Da.
    Residues 122 Isoelectric Point 5.60
    Sequence mvrgirgaitveedtpeaihqatrelllkmleangiqsyeelaaviftvtedltfafpaeaarqigmhr vpllsarevpvpgslprvirvlalwntdtpqdrvrhvylreavrlrpdlesaq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.65 Rfree 0.227
    Matthews' coefficent 2.35 Rfactor 0.204
    Waters 101 Solvent Content 47.36

    Ligand Information
    Ligands MES (2-(N-MORPHOLINO)-ETHANESULFONIC) x 1;GOL (GLYCEROL) x 4
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch