The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structures of Threonine Synthase from Thermus thermophilus HB8: Conformational change, substrate recognition, and mechanism. J.BIOL.CHEM. 278 46035-46045 2003
    Site RSGI
    PDB Id 1uin Target Id ttk003000028.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14169, Molecular Weight 37007.61 Da.
    Residues 351 Isoelectric Point 8.73
    Sequence mrpplieryrnllpvsektpvisllegstpliplkgpeearkkgirlyakyeglnptgsfkdrgmtlav skaveggaqavacastgntaasaaayaaragilaivvlpagyvalgkvaqslvhgarivqvegnfddal rltqklteafpvalvnsvnphrlegqktlafevvdelgdaphyhalpvgnagnitahwmgykayhalgk akrlprmlgfqaagaaplvlgrpverpetlatairignpaswqgavrakeesggvieavtdeeilfayr ylareegifcepasaaamagvfkllregrlepestvvltltghglkdpataervaelpppvparleava aaagll
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.25 Rfree 0.219
    Matthews' coefficent 3.71 Rfactor 0.191
    Waters 211 Solvent Content 66.63

    Ligand Information
    Ligands SO4 (SULFATE) x 3;PLP (PYRIDOXAL-5'-PHOSPHATE) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch