The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Enoyl-CoA Hydratase from Thermus Thermophilus HB8. To be Published
    Site RSGI
    PDB Id 1uiy Target Id ttk003000159.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14253, Molecular Weight 27143.01 Da.
    Residues 253 Isoelectric Point 6.37
    Sequence mvqvekghvavvflndperrnplspemalsllqalddleadpgvravvltgrgkafsagadlaflervt elgaeenyrhslslmrlfhrvytypkptvaavngpavaggaglalacdlvvmdeearlgytevkigfva alvsvilvravgekaakdllltgrlveareakalglvnriappgkaleeakalaeevaknaptslrltk elllalpgmgledgfrlaalanawvretgdlkegiraffekrpprf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.85 Rfree 0.267
    Matthews' coefficent 3.28 Rfactor 0.2035
    Waters 72 Solvent Content 62.18

    Ligand Information
    Ligands DIO (1,4-DIETHYLENE) x 1;GOL (GLYCEROL) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch