.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ujn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of dehydroquinate synthase from Thermus thermophilus HB8 showing functional importance of the dimeric state. Proteins 58 249-252 2005
    Site RSGI
    PDB Id 1ujn Target Id ttk003000002.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14147, Molecular Weight 37508.02 Da.
    Residues 348 Isoelectric Point 9.26
    Sequence mqrlevrepvpypilvgegvlkevpplagpaallfdrrvegfaqevakalgvrhllglpggeaakslev ygkvlswlaekglprnatllvvgggtltdlggfvaatylrgvaylafptttlaivdasvggktginlpe gknlvgafhfpqgvyaelralktlplptfkeglveafkhgliagdeallkvedltpqsprleaflarav avkvrvteedplekgkrrllnlghtlghaleaqtrhalphgmavaygllyaallgralggedllppvrr lllwlsppplpplafedllpyllrdkkkvseslhwvvplapgrlvvrplpegllreafaawreelkglgllr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.236
    Matthews' coefficent 1.99 Rfactor 0.202
    Waters 645 Solvent Content 37.79

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch