The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Stabilization mechanism of the tryptophan synthase alpha-subunit from Thermus thermophilus HB8: X-ray crystallographic analysis and calorimetry. J.Biochem.(Tokyo) 138 343-353 2005
    Site RSGI
    PDB Id 1ujp Target Id ttk003000017.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14160, Molecular Weight 28944.94 Da.
    Residues 271 Isoelectric Point 6.05
    Sequence mttleafakarsegraalipyltagfpsregflqaveevlpyadlleiglpysdplgdgpviqrasela lrkgmsvqgalelvrevraltekplflmtylnpvlawgperffglfkqagatgvilpdlppdedpglvr laqeigletvfllaptstdariatvvrhatgfvyavsvtgvtgmrerlpeevkdlvrrikartalpvav gfgvsgkataaqaavadgvvvgsalvraleegrslapllqeirqglqrleanpglkesskkplp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.34 Rfree 0.221
    Matthews' coefficent 2.07 Rfactor 0.203
    Waters 303 Solvent Content 40.18

    Ligand Information
    Ligands CIT (CITRIC) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch