The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the Villin headpiece domain of human actin-binding LIM protein homologue (KIAA0843 protein). To be Published
    Site RSGI
    PDB Id 1ujs Target Id hsk002000824.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12611, Molecular Weight 9235.21 Da.
    Residues 75 Isoelectric Point 9.89
    Sequence navnwgmreykiypyelllvttrgrnrlpkdvdrtrlerhlsqeefyqvfgmtisefdrlalwkrnelk kqarlf
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch