The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystallographic Structure and Biochemical Analysis of the Thermus thermophilus Osmotically Inducible Protein C. J.MOL.BIOL. 338 959-968 2004
    Site RSGI
    PDB Id 1ukk Target Id ttk003001149.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14528, Molecular Weight 15263.67 Da.
    Residues 142 Isoelectric Point 5.52
    Sequence mpvrkakavwegglrqgkgvmelqsqafqgpysypsrfeegegtnpeeliaaahagcfsmalaaslere gfppkrvstearvhlevvdgkptltriellteaevpgissekfleiaeaakegcpvsralagvkevvlt arlv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.23222
    Matthews' coefficent 1.90 Rfactor 0.17798
    Waters 213 Solvent Content 34.61

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch