.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ukw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Thermus thermophilus medium-chain acyl-CoA dehydrogenase. To be published
    Site RSGI
    PDB Id 1ukw Target Id ttk003000162.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14255, Molecular Weight 45050.55 Da.
    Residues 410 Isoelectric Point 6.31
    Sequence mvawgrgcqglpkildsvkggapggrrsgmpidfslteeqrqlqalarrfakevilpvareydekeevp wpvieklhevgllnaiipeeyggmglkmldevivgeelayacmgiytipmasdlgitpvllagteeqke rflrpltekpalaafalsepgngsdaaalktrairqgdhyvlngtkmwisnggeaewvvvfatvnpelr hkgvvalvvergtpgfkaikihgkmgqrasgtyelvfedvkvpvenrlgeegegfkiamqtlnktripv aagsvgvarraldearkyakerqafgqpianfqaiqfkladmligietarmytyyaawladqglphaha saiakayaseiafeaanqaiqihggygyvrefpvekllrdvklnqiyegtneiqrliiarhilae
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.26
    Matthews' coefficent 2.30 Rfactor 0.207
    Waters 208 Solvent Content 46.14

    Ligand Information
    Ligands FAD (FLAVIN-ADENINE) x 2
    Metals CO (COBALT) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch