.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ukx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the RWD domain of the mouse GCN2 protein. Protein Sci. 13 2089-2100 2004
    Site RSGI
    PDB Id 1ukx Target Id mmk001004460.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13450, Molecular Weight 14141.27 Da.
    Residues 124 Isoelectric Point 5.06
    Sequence mesysqrqdhelqaleaiygsdfqdlrpdargrvreppeinlvlypqglageevyvqvelrvkcpptyp dvvpeidlknakglsnesvnllkshleelakkqcgevmifelahhvqsflsehnk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch