.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ul5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title A novel zinc-binding motif revealed by solution structures of DNA-binding domains of Arabidopsis SBP-family transcription factors. J.Mol.Biol. 337 49-63 2004
    Site RSGI
    PDB Id 1ul5 Target Id atr001006152.1
    Molecular Characteristics
    Source Arabidopsis thaliana
    Alias Ids TPS12241, Molecular Weight 9984.00 Da.
    Residues 86 Isoelectric Point 9.63
    Sequence varcqvpdceadiselkgyhkrhrvclrcatasfvvldgenkrycqqcgkfhllpdfdegkrscrrkle rhnnrrkrkpvdkggva
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch