.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ulh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title A short peptide insertion crucial for angiostatic activity of human tryptophanyl-tRNA synthetase. Nat.Struct.Mol.Biol. 11 149-156 2004
    Site RSGI
    PDB Id 1ulh Target Id trt001000324.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS14137, Molecular Weight 44731.68 Da.
    Residues 390 Isoelectric Point 6.40
    Sequence edfvdpwtvqtssakgidydklivrfgsskidkelinrieratgqrphhflrrgiffshrdmnqvlday enkkpfylytgrgpsseamhvghlipfiftkwlqdvfnvplviqmtddekylwkdltldqaysyavena kdiiacgfdinktfifsdldymgmssgfyknvvkiqkhvtfnqvkgifgftdsdcigkisfpaiqaaps fsnsfpqifrdrtdiqclipcaidqdpyfrmtrdvaprigypkpallhstffpalqgaqtkmsasdpns sifltdtakqiktkvnkhafsggrdtieehrqfggncdvdvsfmyltffledddkleqirkdytsgaml tgelkkalievlqpliaehqarrkevtdeivkefmtprklsfdfq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.31 Rfree 0.292
    Matthews' coefficent 2.71 Rfactor 0.241
    Waters 477 Solvent Content 54.32

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch