.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ulq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of tt0182 from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 1ulq Target Id ttk003000182.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14262, Molecular Weight 42785.70 Da.
    Residues 401 Isoelectric Point 5.99
    Sequence mpeawiveavrtpigkhggalasvrpddllahalsvlvdrsgvpkeevedvyagcanqagednrnvarm alllagfpvevagctvnrlcgsgleavaqaaraiwagegkvyigsgvesmsrapyavpkpergfptgnl vmydttlgwrfvnpkmqalygtesmgetaenlaemygirreeqdrfallshqkavraweegrfqdevvp vpvkrgkeeilveqdegprrdtsleklaalrpvfreggtvtagnssplndgaaavllvsddyakahglr plarvraiavagvpprimgigpvpatrkaleraglsfsdlglielneafaaqalavlrewslsmedqrl npnggaialghplgasgarilttlvhemrrrkvqfglatmcigvgqgiavvvegmg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 3.00 Rfree 0.275
    Matthews' coefficent 2.91 Rfactor 0.218
    Waters Solvent Content 57.40

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch