.
The Open Protein Structure Annotation Network
PDB Keyword
.

1uls

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of tt0140 from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 1uls Target Id ttk003000140.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14246, Molecular Weight 25934.50 Da.
    Residues 245 Isoelectric Point 7.88
    Sequence mrlkdkavlitgaahgigratlelfakegarlvacdieegplreaaeavgahpvvmdvadpasvergfa ealahlgrldgvvhyagitrdnfhwkmpledwelvlrvnltgsflvakaaseamreknpgsivltasrv ylgnlgqanyaaskagvvgltrtlalelgrwgirvnalapgfietrmtakvpekvrekaiaatplgrag kplevayaalfllsdessfitgqvlfvdggrtigaapa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.40 Rfree 0.252
    Matthews' coefficent 2.19 Rfactor 0.196
    Waters 703 Solvent Content 43.45

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch