.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ult

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis of the substrate specific two-step catalysis of long chain fatty acyl-CoA synthetase dimer. J.Biol.Chem. 279 31717-31726 2004
    Site RSGI
    PDB Id 1ult Target Id ttk003000168.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14256, Molecular Weight 59568.26 Da.
    Residues 541 Isoelectric Point 6.07
    Sequence megermnafpstmmdeelnlwdfleraaalfgrkevvsrlhtgevhrttyaevyqrarrlmgglralgv gvgdrvatlgfnhfrhleayfavpgmgavlhtanprlspkeiayilnhaedkvllfdpnllplveairg elktvqhfvvmdekapegylayeealgeeadpvrvperaacgmayttgttglpkgvvyshralvlhsla aslvdgtalsekdvvlpvvpmfhvnawclpyaatlvgakqvlpgprldpaslvelfdgegvtftagvpt vwlaladylestghrlktlrrlvvggsaaprsliarfermgvevrqgygltetspvvvqnfvkshlesl seeekltlkaktglpiplvrlrvadeegrpvpkdgkalgevqlkgpwitggyygneeatrsaltpdgff rtgdiavwdeegyveikdrlkdliksggewissvdlenalmghpkvkeaavvaiphpkwqerplavvvp rgekptpeelnehllkagfakwqlpdayvfaeeiprtsagkflkralreqyknyygga
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.55 Rfree 0.239
    Matthews' coefficent 3.14 Rfactor 0.206
    Waters 287 Solvent Content 60.52

    Ligand Information
    Ligands CIT (CITRIC) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch