The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Ligand-induced Conformational Changes and a Reaction Intermediate in Branched-chain 2-Oxo Acid Dehydrogenase (E1) from Thermus thermophilus HB8, as Revealed by X-ray Crystallography. J.Mol.Biol. 337 1011-1033 2004
    Site RSGI
    PDB Id 1umc Target Id ttk003000456.3
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14367, Molecular Weight 35090.64 Da.
    Residues 324 Isoelectric Point 5.86
    Sequence malmtmvqalnraldeemakdprvvvlgedvgkrggvflvtegllqkygpdrvmdtplseaaivgaalg maahglrpvaeiqfadyifpgfdqlvsqvaklryrsggqftaplvvrmpsgggvrgghhhsqspeahfv htaglkvvavstpydakgllkaairdedpvvflepkrlyrsvkeevpeedytlpigkaalrregkdltl igygtvmpevlqaaaelakagvsaevldlrtlmpwdyeavmnsvaktgrvvlvsdaprhasfvsevaat iaedlldmllappirvtgfdtpypyaqdklylptvtrilnaakraldy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.206
    Matthews' coefficent 3.37 Rfactor 0.172
    Waters 735 Solvent Content 63.18

    Ligand Information
    Ligands TDP (THIAMIN) x 2;4MV (4-METHYL) x 1
    Metals MG (MAGNESIUM) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch