.
The Open Protein Structure Annotation Network
PDB Keyword
.

1umh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis of sugar-recognizing ubiquitin ligase. NAT.STRUCT.MOL.BIOL. 11 365-370 2004
    Site RSGI
    PDB Id 1umh Target Id trt001000323.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS14135, Molecular Weight 20999.07 Da.
    Residues 184 Isoelectric Point 4.53
    Sequence gshfyflskrrrnllrnpcgeedlegwsdvehggdgwkveelpgdngveftqddsvkkyfassfewcrk aqvidlqaegyweelldttqpaivvkdwysgrtdagslyeltvrllsenedvlaefatgqvavpedgsw meishtfidygpgvrfvrfehggqdsvywkgwfgarvtnssvwvep
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.19229
    Matthews' coefficent 3.14 Rfactor 0.15327
    Waters 112 Solvent Content 60.82

    Ligand Information
    Ligands
    Metals NI (NICKEL) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch