.
The Open Protein Structure Annotation Network
PDB Keyword
.

1umi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis of sugar-recognizing ubiquitin ligase. NAT.STRUCT.MOL.BIOL. 11 365-370 2004
    Site RSGI
    PDB Id 1umi Target Id trt001000323.2
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS14136, Molecular Weight 20967.01 Da.
    Residues 184 Isoelectric Point 4.53
    Sequence gshfyflskrrrnllrnpageedlegwsdvehggdgwkveelpgdngveftqddsvkkyfassfewcrk aqvidlqaegyweelldttqpaivvkdwysgrtdagslyeltvrllsenedvlaefatgqvavpedgsw meishtfidygpgvrfvrfehggqdsvywkgwfgarvtnssvwvep
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.2562
    Matthews' coefficent 3.58 Rfactor 0.19693
    Waters 45 Solvent Content 65.67

    Ligand Information
    Ligands NDG-NAG (2-(ACETYLAMINO)-2-DEOXY-A-D-GLUCOPYRANOSE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch