.
The Open Protein Structure Annotation Network
PDB Keyword
.

1us5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the Thermus Thermophilus Putative Periplasmic Glutamate/Glutamine-Binding Protein. Acta Crystallogr.,Sect.D 60 1846 2004
    Site RSGI
    PDB Id 1us5 Target Id ttk003001099.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14521, Molecular Weight 33450.94 Da.
    Residues 314 Isoelectric Point 9.25
    Sequence mrkpilaaltlaglglaqefitigsgsttgvyfpvatgiaklvndanvgiranarstggsvaninaina gefemalaqndiayyayqgccipafegkpvktiralaalypevvhvvarkdagirtvadlkgkrvvvgd vgsgteqnarqileaygltfddlgqairvsasqgiqlmqdkradalfytvglgasaiqqlalttpialv avdlnriqaiakkypfyvgfnipggtykgvdvttptvavqamliaserlseetvykfmkavfgnleafk kihpnlerffglekavkglpiplhpgaerfykeagvlk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.5 Rfree 0.205
    Matthews' coefficent Rfactor 0.184
    Waters 288 Solvent Content

    Ligand Information
    Ligands GLU (1,2-ETHANEDIOL) x 1;EDO x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch