.
The Open Protein Structure Annotation Network
PDB Keyword
.

1usm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Transcriptional Coactivator DCoH from Thermus Thermophilus. To be Published
    Site RSGI
    PDB Id 1usm Target Id ttk003000260.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14310, Molecular Weight 9476.19 Da.
    Residues 80 Isoelectric Point 6.28
    Sequence mdweerenpkrlvktfafpnfrealdfanrvgalaerenhhprltvewgrvtvewwthsaggvtekdre marltdallqr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.2 Rfree 0.228
    Matthews' coefficent 2.15 Rfactor 0.215
    Waters 147 Solvent Content 42.40

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch