.
The Open Protein Structure Annotation Network
PDB Keyword
.

1uz5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of Molybdopterin Biosynthesis Moeaprotein from Pyrococcus Horikosii. To be Published
    Site RSGI
    PDB Id 1uz5 Target Id pho001000582.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13834, Molecular Weight 42797.61 Da.
    Residues 402 Isoelectric Point 6.88
    Sequence maflkvvplekalevvqsfkispgieevpiekglgriaaediyspidvppfdratvdgyavraedtfma seaspvrlkvigsvhageepkfklgkgeaayistgamlpgnadaviqfedvervngeiliykpaypglg vmkkgidiekgrllvkkgerlgfkqtallsavginkvkvfrkpkvavistgneivppgnelkpgqiydi ngralcdainelggegifmgvarddkeslkaliekavnvgdvvvisggasggtkdltasvieelgevkv hgiaiqpgkptiigvikgkpvfglpgyptscltnftllvvplllralgregkigkkvarlkhkvfsvkg rrqflpvklegdlavpilkgsgavtsfidadgfveipetvesldegeevevtlfkgw
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.05 Rfree 0.247
    Matthews' coefficent 4.0 Rfactor 0.218
    Waters 242 Solvent Content 68.1

    Ligand Information
    Ligands SO4 (SULFATE) x 6
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch