The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Thermus Thermophilus Delta(1)- Pyrroline-5-Carboxylate Dehydrogenase. J.Mol.Biol. 362 490 2006
    Site RSGI
    PDB Id 1uzb Target Id ttk003000033.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14177, Molecular Weight 57043.17 Da.
    Residues 516 Isoelectric Point 5.57
    Sequence mtvepfrnepietfqteearramrealrrvreefgrhyplyiggewvdtkermvslnpsapsevvgtta kagkaeaeaaleaawkafktwkdwpqedrsrlllkaaalmrrrkreleatlvyevgknwveasadvaea idfieyyaraalryrypavevvpypgednesfyvplgagvviapwnfpvaiftgmivgpvavgntviak paedavvvgakvfeifheagfppgvvnflpgvgeevgaylvehprirfinftgslevglkiyeaagrla pgqtwfkrayvetggkdaiivdetadfdlaaegvvvsaygfqgqkcsaasrliltqgayepvlervlkr aerlsvgpaeenpdlgpvvsaeqerkvlsyieigknegqlvlggkrlegegyfiaptvftevppkaria qeeifgpvlsvirvkdfaealevandtpygltggvysrkrehlewarrefhvgnlyfnrkitgalvgvq pfggfklsgtnaktgaldylrlflemkavaerf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.4 Rfree 0.190
    Matthews' coefficent Rfactor 0.177
    Waters 1476 Solvent Content

    Ligand Information
    Ligands MRD ((4R)-2-METHYLPENTANE-2,4-DIOL) x 6



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch