The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural Basis of the Substrate-specific Two-step Catalysis of Long Chain Fatty Acyl-CoA Synthetase Dimer. J.Biol.Chem. 279 31717-31726 2004
    Site RSGI
    PDB Id 1v25 Target Id ttk003000168.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14257, Molecular Weight 59568.26 Da.
    Residues 541 Isoelectric Point 6.07
    Sequence megermnafpstmmdeelnlwdfleraaalfgrkevvsrlhtgevhrttyaevyqrarrlmgglralgv gvgdrvatlgfnhfrhleayfavpgmgavlhtanprlspkeiayilnhaedkvllfdpnllplveairg elktvqhfvvmdekapegylayeealgeeadpvrvperaacgmayttgttglpkgvvyshralvlhsla aslvdgtalsekdvvlpvvpmfhvnawclpyaatlvgakqvlpgprldpaslvelfdgegvtftagvpt vwlaladylestghrlktlrrlvvggsaaprsliarfermgvevrqgygltetspvvvqnfvkshlesl seeekltlkaktglpiplvrlrvadeegrpvpkdgkalgevqlkgpwitggyygneeatrsaltpdgff rtgdiavwdeegyveikdrlkdliksggewissvdlenalmghpkvkeaavvaiphpkwqerplavvvp rgekptpeelnehllkagfakwqlpdayvfaeeiprtsagkflkralreqyknyygga
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.23956
    Matthews' coefficent 2.50 Rfactor 0.2045
    Waters 421 Solvent Content 50.36

    Ligand Information
    Metals MG (MAGNESIUM) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch