.
The Open Protein Structure Annotation Network
PDB Keyword
.

1v2e

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structures of glutamine:phenylpyruvate aminotransferase from Thermus thermophilus HB8: induced fit and substrate recognition. J.BIOL.CHEM. 279 16518-16525 2004
    Site RSGI
    PDB Id 1v2e Target Id ttk003000293.3
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14323, Molecular Weight 42268.23 Da.
    Residues 381 Isoelectric Point 5.91
    Sequence mrlhprteaakesifprmsglaqrlgavnlgqgfpsnppppflleavrralgrqdqyappaglpalrea laeefavepesvvvtsgatealyvllqslvgpgdevvvlepffdvylpdaflagakarlvrldltpegf rldlsalekaltprtralllntpmnptglvfgereleaiarlarahdlflisdevydelyygerprrlr efapertftvgsagkrleatgyrvgwivgpkefmprlagmrqwtsfsaptplqagvaealklarregfy ealregyrrrrdllagglramglrvyvpegtyflmaelpgwdafrlveearvalipasafyledppkdl frfafckteeelhlalerlgrvvnspreaeggavsg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.60 Rfree 0.286
    Matthews' coefficent 3.18 Rfactor 0.231
    Waters 87 Solvent Content 61.29

    Ligand Information
    Ligands PLP (PYRIDOXAL-5'-PHOSPHATE) x 2;KMT (4-(METHYLSULFANYL)-2-OXOBUTANOIC) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch