The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structures of glutamine:phenylpyruvate aminotransferase from Thermus thermophilus HB8: induced fit and substrate recognition. J.BIOL.CHEM. 279 16518-16525 2004
    Site RSGI
    PDB Id 1v2f Target Id ttk003000293.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14322, Molecular Weight 42268.23 Da.
    Residues 381 Isoelectric Point 5.91
    Sequence mrlhprteaakesifprmsglaqrlgavnlgqgfpsnppppflleavrralgrqdqyappaglpalrea laeefavepesvvvtsgatealyvllqslvgpgdevvvlepffdvylpdaflagakarlvrldltpegf rldlsalekaltprtralllntpmnptglvfgereleaiarlarahdlflisdevydelyygerprrlr efapertftvgsagkrleatgyrvgwivgpkefmprlagmrqwtsfsaptplqagvaealklarregfy ealregyrrrrdllagglramglrvyvpegtyflmaelpgwdafrlveearvalipasafyledppkdl frfafckteeelhlalerlgrvvnspreaeggavsg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.35 Rfree 0.222
    Matthews' coefficent 3.20 Rfactor 0.188
    Waters 167 Solvent Content 61.58

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch