.
The Open Protein Structure Annotation Network
PDB Keyword
.

1v32

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the SWIB/MDM2 domain of the hypothetical protein At5g08430 from Arabidopsis thaliana. To be Published
    Site RSGI
    PDB Id 1v32 Target Id atr001006188.1
    Molecular Characteristics
    Source Arabidopsis thaliana
    Alias Ids TPS12242, Molecular Weight 10403.53 Da.
    Residues 88 Isoelectric Point 9.27
    Sequence krfefvgwgsrqlieflhslgkdtsemisrydvsdtiakyiskeglldpsnkkkvvcdkrlvllfgtrt ifrmkvydllekhykenqd
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch