.
The Open Protein Structure Annotation Network
PDB Keyword
.

1v33

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the Pyrococcus horikoshii DNA primase-UTP complex: implications for the mechanism of primer synthesis. Genes Cells 8 913-923 2003
    Site RSGI
    PDB Id 1v33 Target Id trt001000255.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS14114, Molecular Weight 42565.78 Da.
    Residues 366 Isoelectric Point 9.14
    Sequence mgsshhhhhhssglvprgshmllrevtreerknfytnewkvkdipdfivktlelrefgfdhsgegpsdr knqytdirdledyiratapyavyssvalyekpqemegwlgtelvfdidakdlplrrcehepgtvcpicl ndakeivrdtviilreelgfndihiiysgrgyhirvldewalkldsksrerilsfvsaseiedveefrk lllnkrgwfvlnhgyprafrlrfgyfilriklphlinagirksiaksilkskeeiyeefvrkailaafp qgvgieslaklfalstrfsksyfdgrvtvdlkrilrlpstlhskvgliakyvgtnerdvmrfnpfkhav pkfrkeevkveykkfleslgt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.2442
    Matthews' coefficent 2.57 Rfactor 0.219
    Waters 154 Solvent Content 51.85

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1
    Metals ZN (ZINC) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch