.
The Open Protein Structure Annotation Network
PDB Keyword
.

1v3u

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis of leukotriene B4 12-hydroxydehydrogenase/15-Oxo-prostaglandin 13-reductase catalytic mechanism and a possible Src homology 3 domain binding loop. J.Biol.Chem. 279 22615-22623 2004
    Site RSGI
    PDB Id 1v3u Target Id my_001000011.2
    Molecular Characteristics
    Source Cavia porcellus
    Alias Ids TPS13672, Molecular Weight 36188.15 Da.
    Residues 333 Isoelectric Point 8.47
    Sequence spefmvkakswtlkkhfqgkptqsdfelktvelpplkngevllealflsvdpymriaskrlkegavmmg qqvarvvesknsafpagsivlaqsgwtthfisdgkgleklltewpdklplslalgtigmpgltayfgll evcgvkggetvlvsaaagavgsvvgqiaklkgckvvgaagsdekiaylkqigfdaafnyktvnsleeal kkaspdgydcyfdnvggeflntvlsqmkdfgkiaicgaisvynrmdqlppgpspesiiykqlriegfiv yrwqgdvrekalrdlmkwvlegkiqyhehvtkgfenmpaafiemlnganlgkavvta
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.257
    Matthews' coefficent 2.11 Rfactor 0.214
    Waters 748 Solvent Content 41.14

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 7

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch