The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of peptide deformylase from Thermus thermophilus HB8. to be published
    Site RSGI
    PDB Id 1v3y Target Id ttk003000998.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14504, Molecular Weight 22091.16 Da.
    Residues 192 Isoelectric Point 5.16
    Sequence mvypirlygdpvlrrkarpvedfsgikrlaedmletmfeakgvglaapqiglsqrlfvaveyadepege eerplrelvrrvyvvanpvityreglvegtegclslpglyseevpraerirveyqdeegrgrvlelegy marvfqheidhldgilfferlpkpkreafleanraelvrfqkearallkelsqg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.81 Rfree 0.20849
    Matthews' coefficent 2.43 Rfactor 0.17086
    Waters 294 Solvent Content 48.88

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch