The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a novel zinc-binding ATP sulfurylase from Thermus thermophilus HB8. Biochemistry 43 4111-4118 2004
    Site RSGI
    PDB Id 1v47 Target Id ttk003000343.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14338, Molecular Weight 38835.94 Da.
    Residues 349 Isoelectric Point 8.69
    Sequence mvetlpaleigederldlenlatgaffpvkgfmtreealsvahemrlptgevwtipillqfrekprvgp gntvallhggervallhvaeayeldlealaravfgtdsethpgvarlygkgpyalagrvevlkprprtp lektpeevraffrqrgwrkvvafqtrnaphraheylirlgleladgvlvhpilgakkpddfptevivea yqalirdflpqervaffglatpmryagpkeavfhalvrknfgathflvgrdhagvgdfydpyaahrifd rlpplgieivkvgavfhcplcggiasertcpeghrekrtaismtkvrallregkappselvrpellpilrrgv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.49 Rfree 0.269
    Matthews' coefficent 3.47 Rfactor 0.219
    Waters 164 Solvent Content 63.95

    Ligand Information
    Metals ZN (ZINC) x 2;CL (CHLORIDE) x 5;NA (SODIUM) x 4



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch