The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Structure Of UDP-N-Acetylglucosamine 2-Epimerase From Thermus Thermophilus HB8. To be Published
    Site RSGI
    PDB Id 1v4v Target Id ttk003001086.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14519, Molecular Weight 40880.46 Da.
    Residues 376 Isoelectric Point 7.90
    Sequence meggmkrvvlafgtrpeatkmapvylalrgipglkplvlltgqhreqlrqalslfgiqedrnldvmqer qalpdlaarilpqaaralkemgadyvlvhgdtlttfavawaaflegipvghveaglrsgnlkepfpeea nrrltdvltdldfaptplakanllkegkreegilvtgqtgvdavllaaklgrlpeglpegpyvtvtmhr renwpllsdlaqalkrvaeafphltfvypvhlnpvvreavfpvlkgvrnfvlldpleygsmaalmrasl llvtdsgglqeegaalgvpvvvlrnvterpeglkagilklagtdpegvyrvvkgllenpeelsrmrkak npygdgkaglmvargvawrlglgprpedwlp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.235
    Matthews' coefficent 2.37 Rfactor 0.209
    Waters 974 Solvent Content 47.64

    Ligand Information
    Ligands ACY (ACETIC) x 1;GOL (GLYCEROL) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch