.
The Open Protein Structure Annotation Network
PDB Keyword
.

1v5l

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of PDZ domain of mouse Alpha-actinin-2 associated LIM protein. To be Published
    Site RSGI
    PDB Id 1v5l Target Id mmt007020726.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13588, Molecular Weight 9577.40 Da.
    Residues 90 Isoelectric Point 6.75
    Sequence nvvlpgpapwgfrlsggidfnqplvitritpgskaaaanlcpgdvilaidgfgtesmthadaqdrikaa syqlclkidraetrlwspqvs
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch